PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G195600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 228aa    MW: 24977.4 Da    PI: 8.2437
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G195600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-2964117154
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                         k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQ  R
  Seita.3G195600.1.p  64 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQVQR 117
                         79*************************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.68861121IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2762117IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1463118IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-2364118IPR006447Myb domain, plants
PfamPF002495.9E-666115IPR001005SANT/Myb domain
PfamPF143794.2E-10112139IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MTLEIRSTGL TLTGVNGKEH ARYTVRLDPV RLPLSGPARA PGRPDPRGPV REAPAPPETA  60
GSGKQRLRWT SDLHNRFVDA IAQLGGPDRA TPKGVLTVMG VPGITIYHVK SHLQVQRQLQ  120
LRIEAQGRYL QMIIEEQQKL GGSIKASEDQ KLLHSPPSLD EYPESTQPSP KKPRMDALSP  180
DSERDTIQPE FESHLIGPWD QEICGKNICG VAFPVEEFKA DPGMSKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9752615e-75EU975261.1 Zea mays clone 485946 MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961661.11e-102PREDICTED: protein PHR1-LIKE 1-like
TrEMBLK3Z8V21e-102K3Z8V2_SETIT; Uncharacterized protein
STRINGSi022972m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79133343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.16e-32G2-like family protein